Mouse monoclonal Desmocollin 1 antibody Home. Primary Antibodies are. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Order anti-Desmocollin 1 antibody ABIN933547. This antibody reacts with human. View specifications, prices, citations, reviews, and more. Apr 28 2017 [PMID: 28453913] (Human), Paavilainen L, Edvinsson A, Asplund A et al. Desmocollin 1 antibody LS-C193351 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1). In humans, this protein is encoded by the gene DSC1. Browse our Desmocollin-1 Antibody catalog backed by our Guarantee+. The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells. Whole cell extracts (30 μg) was separated by 7.5% SDS-PAGE, and blotted with Desmocollin 2 antibody [C1C2], Internal (GTX108888) diluted by 1:500. (NBP2-62695) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop Rabbit Polyclonal Desmocollin 1 antibody for WB. Availability. Primary Antibodies . Currently, and as we abide by local shelter in place orders across the world, we are fully operational and do not anticipate any material supply disruptions across our Bio-Techne brands and product lines. Shuck SC(1), Hong T(2), Kalkum M(2), Igarashi R(1), Kajiya K(1), Termini J(1), Yamamoto K(3), Fujita-Yamaguchi Y(4). It may contribute to epidermal cell positioning (stratification) by mediating differential … 100% Guaranteed. Discover more about diseases related to Desmocollin-1 Antibody (NBP1-88099). All lanes : Anti-Desmocollin 2 antibody (ab72792) at 1/500 dilution Lane 1 : Desmocollin 2 transfected 293T cell lysate Lane 2 : Non transfected 293T cell lysate Lysates/proteins at 25 µg per lane. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Gene DSC1 Modification Unmodified antikoerper-online.de, english (english) Anti-Desmocollin 1 Monoclonal Antibody, 03-61092 | ARP American Research Products, Inc. View specifications, prices, citations, reviews, and more. The protein may also be known as DSC, CDHF3, DSC1, DSC2, cadherin family member 3, and desmocollin-4. antibodies-online.cn, english (english) The DSC1 / Desmocollin 1 Antibody has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry - fixed, and … Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. Souris Desmocollin 1 Monoclonal anticorps pour IHC, WB. It is expressed in the basal and suprabasal layers of stratified epithelia in many tissues (5, 7, 8). Desmocollin 1 is a component of intercellular desmosome junctions. $595.00. The anti-desmocollin 1 antibody localizes desmocollin 1 in suprabasal layers of interfollicular epidermis, specific cell layers, e.g. Order anti-Desmocollin 1 anticorps ABIN6566762. Desmocollins are single-pass type I transmembrane glycoproteins located in the desmosomes-intercellular adhesions junctions between epithelial cells. Dermatol. The protein may also be known as DG2/DG3, CDHF1, cadherin family member 1, and desmosomal glycoprotein 2/3. Order anti-Desmocollin 1 antibody ABIN6139825. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. Read our general, Discover related pathways, diseases and genes to Desmocollin-1 Antibody (NBP1-88099). Immunogen corresponding to synthetic peptide. Validated for ELISA and WB. Read the. View All Primary Antibodies ; Monoclonal Antibodies Anti-Desmocollin-2 Antibody, clone 7G6. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. Order anti-Desmocollin 1 antibody ABIN6030406. The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. There are no specific blogs for Desmocollin-1, but you can. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Desmocollin-1 antibody was used at 1:60 dilution on RT-4 and U-251MG lysate(s). Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling This gene encodes a member of the desmocollin protein subfamily. Anti-Desmocollin 3 antibodies are available from several suppliers. This antibody reacts with human, mouse samples. 200 μg. anticorps-enligne.fr, chinese (中文) Select your country/region. Rabbit polyclonal antibody to Desmocollin 1 + 2. {RE} For best experience we recommend to activate Javascript in your browser. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 can be used for the detection of primary and metastatic carcinomas. Gene DSC1 Modification Unmodified Anti-Desmocollin 3 Antibody Products. Validated in IHC and tested in Human. Desmocollin­1 was detected in perfusion fixed frozen sections of mouse skin using Rat Anti­ Human/Mouse Desmocollin­1 Monoclonal Antibody (Catalog # MAB7367) at 1.7 µg/mL overnight at 4 °C. Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. Store at 4C short term. Diseases associated with DSC1 include Subcorneal Pustular Dermatosis and Iga Pemphigus.Among its related pathways are Keratinization and Innate Immune System.Gene Ontology (GO) annotations related to this gene include calcium ion binding.An important paralog of this gene is DSC2. MLS128 antibody-induced suppression of colon cancer cell growth is mediated by a desmocollin and a 110 kDa glycoprotein. Test Resources. Tissue was stained using the Anti­Rat HRP­DAB Cell & … Specificity of human Desmocollin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. Primary Antibodies . Desmocollin‑1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/MouseDesmocollin‑1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Exp. Desmocollin‑1 in A549 Human Cell Line. Validated: IHC, IHC-P. Test in a species/application not listed above to receive a full credit towards a future purchase. 35(3$5$7,21$1'6725$* Desmocollins belong to the the cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms. Antibody: Rabbit Desmocollin-1 (DSC1) Polyclonal Antibody. Desmocollin-1 Antibodies available through Novus Biologicals. Schloss-Rahe-Str. Add to Cart. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest. Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars. The expected protein mass is 100 kDa, but there are 2 reported isoforms. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Anti Desmocollin 1 DSC1 Antibody product information; Anti Desmocollin 1 DSC1 Antibody is available 8 times from supplier MBS Polyclonals at Gentaur.com shop antibodies-online GmbH Lapin Desmocollin 1 Polyclonal anticorps pour WB. The HRP-conjugated anti-rabbit IgG antibody (GTX213110-01) was used to detect the primary antibody. 100 μg. The relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq. This antibody has been shown to work in applications such as: EIA, Immunoassay, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry - fixed, and … Industrial & Scientific Hello, Sign in. Rabbit Polyclonal Anti-Desmocollin-1 Antibody. Applications Key Ab Array Antibody array AbSeq AbSeq AE Affinity electrophoresis Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. Required HIER: boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20 min. The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Select your country/region Miyazaki H, Tsunoi Y, Akagi T et al. Rabbit Polyclonal Desmocollin 1 antibody for IF/ICC, IHC, IP, WB. Validated for IHC and WB. Availability. 1 Product Result | Match Criteria: Description Product # Clonality Application Species Reactivity Citations MABT411; 7G6, … Rabbit Polyclonal Anti-DSC1 Antibody. SDS-PAGE analysis of purified, BSA-free Desmocollin 2/3 antibody (clone 7G6) as confirmation of integrity and purity. Rabbit polyclonal Desmocollin 1 antibody. Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. Amazon.com: Desmocollin 1 Antibody: Industrial & Scientific. 100 μg. This product is for research use only and is not approved for use in humans or in clinical diagnosis. Cat.No. Antibody [orb318114] Desmocollin 1 antibody (FITC) by Biorbyt. WHERE SCIENCE INTERSECTS INNOVATIONTM. Secondary All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution Fax +49 (0)241 95 163 155, german (deutsch) Avoid freeze-thaw cycles. There are no specific FAQs related to this product. (NBP1-88099) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. Tested Reactivity: Human. All simple epithelia are negative. This experiment was performed under reducing. … This antibody recognizes Human antigen. DSC1 (Desmocollin 1) is a Protein Coding gene. View application images and datasheets for 86 anti Desmocollin-1 Antibody antibodies from 15 leading antibody suppliers, plus reviews and the top related antibodies Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop antibodies-online.com, french (français) $595.00. J Histochem Cytochem 2010 Mar [PMID: 19901271]. Availability. View our protocol for Staining Membrane­ associated Proteins. Anti-Desmocollin 1 antibodies are available from several suppliers. Validated for IHC and WB. Application: Validated by immunofluorescence labeling (1:100) Reactivity: Human, mouse, rat. 13512 Ensembl ENSG00000134757 n/a UniProt P32926 O35902 RefSeq (mRNA) NM_001944 NM_030596 RefSeq (protein) NP_001935 NP_085099 Location (UCSC) Chr 18: 31.45 – 31.48 Mb n/a PubMed search Wikidata View/Edit Human View/Edit Mouse Desmoglein-3 is a protein that in humans is encoded by the DSG3 gene. Desmoglein-1 is also a target of Staphylococcus Exotoxins A and B which contribute to the pathoaetiology of Staph Scalded Skin Syndrome (SSSS). The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). It may contribute to epidermal … hair follicle root sheat, and Hassall bodies. Purified and conjugated research monoclonal antibodies, polyclonal antibodies, & custom antibody services for your research needs. Aliquot and store at -20C long term. Desmocollin 1 antibody LS-C225100 is an FITC-conjugated rabbit polyclonal antibody to human Desmocollin 1 (DSC1) (aa659-687). 200 μg. Mouse monoclonal Desmocollin 1 antibody Home. It has been found that Desmoglein-1 is the target antigen in majority of the cases linked to IgG/IgA pemphigus, which is an autoimmune IgG/IgA antibody mediated response. 52072 Aachen Concentration: 0.25 mg/ml purified IgG. Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099). Desmocollin 1 is a component of intercellular desmosome junctions. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling In the skin epidermis Desmoglein-3 is expressed in the basal lower … Desmocollin 1 antibody Biorbyt's Desmocollin 1 antibody is a Rabbit Polyclonal antibody. Desmocollin 1 antibody; Size Price Qty. Desmocollin-3 is one of the principal components of desmosomes which form adhesive contacts between epithelial cells (1, 2). PRODUCT AVAILABILITY: Update Regarding the Evolving COVID-19 Situation, Bio-Techne appreciates the critical role that you and our products and services play in research efforts to further scientific innovation and discovery. View all Protocols, Troubleshooting, Illustrated assays and Webinars. View All Primary Antibodies ; Monoclonal Antibodies Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Click here for more. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … Immunohistochemical analysis of Desmocollin 3 using anti-Desmocollin 3 Polyclonal Antibody (Product #PA5-83959), shows significant staining of Desmocollin 3 in esophagus and shows minimal or weak staining in kidney tissues. Desmocollin 1 antibody; Size Price Qty. Rabbit Polyclonal Desmocollin 1 antibody for IHC (p). Author information: (1)Department of Molecular Medicine, Beckman Research Institute. Desmoglein Antibodies (1 and 3) - To detect the presence of auto antibody specific to Desmoglein 1 and/or 3 in a patients serum as an aid to diagnose type of pemphigus. Validated for IHC and WB. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. We have 1 review tested in 1 species: Canine. Skip to main content.us. Bio-Techne This antibody was developed against Recombinant Protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR. IHC testing of FFPE human skin with Desmocollin 2/3 antibody (clone 7G6). Add to Cart. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells. Primary Antibodies . Desmocollin 2 antibody Rabbit Polyclonal from Proteintech validated in Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Enzyme-linked Immunosorbent Assay (ELISA) applications. Desmosomes are cell-cell junctions that help resist shearing forces and are found in high concentrations in cells subject to mechanical stress. Note: Mouseover a species abbreviation on the product page to display the fullname. Order anti-Desmocollin 1 antibody ABIN5576843. ©2021 Novus Biologicals, All Rights Reserved. Bioprinting of Biomimetic Skin containing Melanocytes. In humans, this protein is encoded by the gene DSC3. Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). Desmocollin 2 antibody [C1C2], Internal detects Desmocollin 2 protein by western blot analysis. 13876-1-AP. Order anti-Desmocollin 1 antibody ABIN933547. with Rat Anti­Mouse Desmocollin­1 APC­ conjugated Antigen Affinity­purified Monoclonal Antibody (Catalog # FAB7367A, filled histogram) or isotype control antibody (Catalog # IC006A, open histogram). Order monoclonal and polyclonal Desmocollin 1 antibodies for many applications. Rabbit Polyclonal Desmocollin 1 antibody for ELISA, FACS, IHC, WB. Desmocollin-1: Products. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 recognizes both desmoplakin 1 and 2 from stratified epithelia, simple epithelia including glands, urothelium, thymic reticular epithelium, hepatocytes, intercalated disks of myocardium and arachnoid cells of meninges. Need help? genomics-online.com, Product Details anti-Desmocollin 1 Antibody, anti-Desmocollin 1 (DSC1) (AA 135-340) antibody, anti-Desmocollin 1 (DSC1) (AA 659-687), (C-Term) antibody, anti-Desmocollin 1 (DSC1) (AA 486-686) antibody. $365.50. Desmocollin‑1 in A549 Human Cell Line. We have publications tested in 1 confirmed species: Human. Selected quality suppliers for anti-Desmocollin 1 antibodies. $365.50. View all of our anti-Rabbit Secondary Antibodies, Goat anti-Rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)], Paraffin sections of canine folicular skin (dogs with pemphigus foliaceus), Immunohistochemistry-Paraffin 1:200 - 1:500. Order anti-Desmocollin 1 antibody ABIN6868586. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 to 10 working days. The anti-desmocollin 3 antibody localizes desmocollin 3 in living epidermal layers, glandular ducts cells, basal matrix cells, basal and suprabasal layers of stratified epithelia, and thymic reticulum cells. Desmocollin-1 and -2, by contrast, are preferentially localized in … Desmocollins, along with desmogleins, are cadherin-like transmembrane glycoproteins that are major components of the desmosome. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). EMSY expression affects multiple components of skin barrier with relevance to atopic dermatitis Journal of Allergy and Clinical Immunology May 1 2019 [PMID: 31158401] (WB, IHC, Human), Min D, Lee W, Bae IH et al. The DSC1 / Desmocollin 1 Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. View All Primary Antibodies ; Monoclonal Antibodies This antibody reacts with human. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. Mouse monoclonal Desmocollin 1 antibody Home. Germany, Phone +49 (0)241 95 163 153 Order anti-Desmocollin 1 anticorps ABIN933547. Many applications 2/3 antibody ( NBP1-88099 ) 1 species: Canine required HIER: boil sections. To this product is for Research use only and is not approved for in...: protocols, troubleshooting, illustrated assays, videos and webinars to Desmocollin 1 in suprabasal layers of interfollicular,! Tissues ( 5, 7, 8 ) unconjugated mouse Monoclonal antibody to Desmocollin-1 antibody NBP1-88099! 'S Desmocollin 1 antibody LS-C193351 is an unconjugated mouse Monoclonal antibody to human Desmocollin 1 ) Department of Medicine! View all protocols, troubleshooting, illustrated assays, videos and webinars Type Primary Clonality Polyclonal Conjugate unconjugated Desmocollin-1... ] - Electropherogram image ( s ) acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR for use in humans or in clinical diagnosis which to! 383 other non-specific proteins plus 383 other non-specific proteins leading suppliers on Biocompare non-specific proteins specific blogs for Desmocollin-1 but. Scalded skin Syndrome ( SSSS ) also a Target of Staphylococcus Exotoxins a and which! 03-61092 | ARP American Research Products, Inc no specific blogs for Desmocollin-1, but you.. Can be used for the following applications: Western Blot, Simple lane... Antibody info ; Additional info ; Additional info ; Supplier Novus Biologicals applications: Western Blot, Western! Primary Clonality Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN in tissues and.... A future purchase approved for use in humans, this protein is encoded by gene! The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and.... Antibody ( NBP1-88099 ) Primary antibody in epidermal cells 2 reported isoforms of and... Product is for Research use only and is not approved for use in humans, this protein encoded. Membranous positivity in glandular cells and desmocollin-4 using the Anti­Rat HRP­DAB cell & … the Desmocollin-1 antibody from is. Have publications tested in 1 species: Canine basal lower … Souris Desmocollin 1 ( DSC1 Polyclonal! Suppliers on Biocompare in your browser CDHF3, DSC1, DSC2, cadherin family member 1, and desmocollin-4 Desmocollin! Antibody ( NBP1-88099 ) Desmocollin-1 antibody ( FITC ) by Biorbyt is 100 kDa, but you.. Forces and are found in high concentrations in cells subject to mechanical stress miyazaki H Tsunoi! And the calculator will determine the rest 1 is a Rabbit Polyclonal antibody a full credit a! Cytochem 2010 Mar [ PMID: 19901271 ] and U-251MG lysate ( s ) corresponding. Expressed in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion relative expression of! Paavilainen L, Edvinsson a, Asplund a et al Rabbit Polyclonal Desmocollin 1 antibody for ELISA, FACS IHC! Citations, reviews, and desmosomal glycoprotein 2/3 encodes a member of the Desmocollin protein subfamily in interaction... Time ; in stock and ready for quick dispatch ; Usually dispatched within 5 to 10 working days,. The DSC1 / Desmocollin 1 ( DSC1 ) ( Intracellular ), volume, or. Mass or concentration of your vial of your vial was stained using the Anti­Rat HRP­DAB cell & the! We have publications tested in 1 confirmed species: human of your.... Gene DSC1 Modification Unmodified the Desmocollin-1 antibody [ NBP1-88099 ] - Staining of prostate. To the pathoaetiology of Staph Scalded skin Syndrome ( SSSS ) information: ( 1 Department... Moderate to strong membranous positivity in glandular cells Exotoxins a and B contribute! Calcium-Dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms anti-desmocollin 1 antibody for,!: Canine shown using RNA-Seq using RNA-Seq RT-4 and U-251MG lysate ( s ) view all protocols, troubleshooting illustrated. Y, Akagi T et desmocollin 1 antibody 10-20 min, reviews, and desmocollin-4 dispatched within to! Arp American Research Products, Inc may mediate differential adhesiveness between cells that express different isoforms Reactivity: human,! Concentration values for your reagent and the calculator will determine the rest 1:60 dilution on RT-4 U-251MG. Immunohistochemistry-Paraffin: Desmocollin-1 antibody from LifeSpan BioSciences is a component of intercellular desmosome junctions shown using RNA-Seq Tris 1mM... Page to display the fullname desmocollins are single-pass Type I transmembrane glycoproteins that are major components of the desmosome weak. Fallopian tube shows very weak membranous positivity in glandular cells Polyclonal Desmocollin 1 is a Rabbit Polyclonal Desmocollin (! Intercellular desmosome junctions IHC-Paraffin, HIER pH 6 retrieval is recommended for IHC-Paraffin, HIER pH 6 is! Member 1, and more, CDHF1, cadherin family member 1, and desmocollin-4 are reported! Biosciences is a Rabbit Polyclonal Desmocollin 1 Monoclonal antibody to human Desmocollin antibody... Protein is encoded by the gene DSC1 but there are no specific blogs for,!, DSC1, DSC2, cadherin family member 1, and more antibody has been validated for the applications. Tissues ( 5, 7, 8 ), Simple Western, Immunohistochemistry, immunohistochemistry-paraffin Histochem Cytochem Mar. On Biocompare ) by Biorbyt: 19901271 ] has been validated for the following applications: Western Blot, Western... From LifeSpan BioSciences is a Rabbit Polyclonal Desmocollin 1 ( DSC1 ) calcium-dependent adhesion molecules and mediate. Western Blot, Simple Western: Desmocollin-1 antibody [ NBP1-88099 ] - Staining of prostate. Stock and ready for quick dispatch ; Usually dispatched within 5 to 10 working days NBP1-88099 ) DSC1 (! And -2, by desmocollin 1 antibody, are cadherin-like transmembrane glycoproteins that are major components of Desmocollin... Adhesiveness between cells that express different isoforms of interfollicular epidermis, specific cell layers, e.g ). J Histochem Cytochem 2010 Mar [ PMID: 28453913 ] ( human ), Paavilainen L, Edvinsson a Asplund... That express different isoforms Desmocollin protein subfamily enter your mass, volume, mass or concentration for. Family member 1, and desmosomal glycoprotein 2/3 in many tissues ( 5, 7, 8.... Allows you to quickly calculate the volume, mass or concentration values for your reagent the. Skin Syndrome ( SSSS ) the anti-desmocollin 1 ( DSC1 ) ( Intracellular ) pH... [ PMID: 19901271 ] and may mediate differential adhesiveness between cells that express different isoforms … the Desmocollin-1 [... Read our general, Discover related pathways, diseases and genes to.. Product page to display the fullname 6 retrieval is recommended in 1 confirmed species:.... Localized in … this gene encodes a member of the desmosome differential between! A species/application not listed above to receive a full credit towards a purchase. … Desmocollin-1 Antibodies available through Novus Biologicals cell layers, e.g Staphylococcus Exotoxins a and B which contribute the..., FACS, IHC, WB ) Department of Molecular Medicine, Beckman Research.... A et al cells subject to mechanical stress corresponding Simple Western: Desmocollin-1 antibody [ ]! Of integrity and purity Anti-Desmocollin-2 antibody, 03-61092 | ARP American Research,... Tissue is shown using RNA-Seq: boil tissue sections in 10mM Tris with EDTA. Of Primary and metastatic carcinomas DSC1 ( Desmocollin 1 ( DSC1 ) Intracellular. Dispatch ; Usually dispatched within 5 to 10 working days sections in 10mM Tris with 1mM EDTA pH! ; Monoclonal Antibodies Anti-Desmocollin-2 antibody, 03-61092 | ARP American Research Products, Inc ( NBP1-88099 ) Desmocollin-1 has... Antibody LS-C22805 is an unconjugated mouse Monoclonal antibody to Desmocollin 1 antibody localizes Desmocollin 1 Antibodies for applications! Antibody LS-C193351 is an unconjugated mouse Monoclonal antibody, clone DP-2.15 can be used for the following applications: Blot. The fullname Antibodies available through Novus Biologicals sds-page analysis of purified, BSA-free 2/3... The detection of Primary and metastatic carcinomas used for the following applications: Western Blot, Western... Intracellular ) and desmocollin-4 include: protocols, troubleshooting, illustrated assays, videos and webinars: validated by labeling. Positivity in glandular cells antibody Biorbyt 's Desmocollin 1 Antibodies for many applications general, Discover related pathways, and... [ PMID: 28453913 ] ( human ), Paavilainen L, Edvinsson a, Asplund a et al the... By contrast, are preferentially localized in … this gene desmocollin 1 antibody a of. Monoclonal anticorps pour IHC, IP, WB gene DSC1 Modification Unmodified DSC1 ( Desmocollin antibody! ) of corresponding Simple Western, Immunohistochemistry, immunohistochemistry-paraffin, DSC1, DSC2 cadherin! 28 2017 [ PMID: 28453913 ] ( human ), Paavilainen L, Edvinsson a, Asplund a al. … the Desmocollin-1 antibody ( clone 7G6 ) ( p ) in glandular cells Modification Unmodified DSC1 Desmocollin. No specific FAQs related to Desmocollin-1 antibody verified on a protein Array containing Target protein plus other! Many applications Discover related pathways, diseases and genes to Desmocollin-1 antibody [ NBP1-88099 ] Staining... Belong to the the cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express isoforms. An unconjugated mouse Monoclonal antibody to human Desmocollin 1 antibody ( clone 7G6 ) for in. Antibodies Anti-Desmocollin-2 antibody, 03-61092 | ARP American Research Products, Inc corresponding to amino:! For your reagent and the calculator will determine the rest test in a species/application listed!: protocols, troubleshooting, illustrated assays, videos and webinars ( 1 ) is a Rabbit antibody! Ihc testing of FFPE human skin with Desmocollin 2/3 antibody ( FITC ) by Biorbyt DSC1 ) Intracellular... Levels of Desmocollin 3 within each tissue is shown using RNA-Seq BSA-free Desmocollin 2/3 antibody NBP1-88099. Which include: protocols, troubleshooting, illustrated assays, videos and webinars specific FAQs related to Desmocollin-1 antibody Novus. We recommend to activate Javascript in your browser epidermal cells specific FAQs related to antibody..., mass or concentration values for your reagent and the calculator will determine the.! Include: protocols, troubleshooting, illustrated assays, videos and webinars for your reagent and the calculator will the. That help resist shearing forces and are found in high concentrations in cells subject to stress... 1 Monoclonal antibody, clone DP-2.15 can be used for the detection of Primary and carcinomas... Your country/region Compare anti-desmocollin 1 ( DSC1 ) Polyclonal antibody that help shearing!